- PPP3CC Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86656
- Human
- Rabbit
- 0.1 ml (also 25ul)
- This antibody was developed against Recombinant Protein corresponding to amino acids: RGFSLQHKIR SFEEARGLDR INERMPPRKD SIHAGGPMKS VTSAHSHAAH RSDQGKKAHS
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- CALNA3, CNA3, PP2Bgamma
- PPP3CC
- Unconjugated
- protein phosphatase 3 catalytic subunit gamma
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- B Cell Development and Differentiation Markers, Cell Biology, Cytoskeleton Markers, Immunology, Neurodegeneration, Neuroscience, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
RGFSLQHKIRSFEEARGLDRINERMPPRKDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS
Specifications/Features
Available conjugates: Unconjugated